PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn096691
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family G2-like
Protein Properties Length: 322aa    MW: 36425.2 Da    PI: 10.7612
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn096691genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.52.7e-32156209255
     G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Achn096691 156 PRMRWTTTLHARFVHAVELLGGQERATPKSVLELMDVKDLTLAHVKSHLQMYRT 209
                 9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.47E-15153209IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-28154209IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-23156209IPR006447Myb domain, plants
PfamPF002492.8E-7157208IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0048481Biological Processplant ovule development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MELFPAQPDL SLQINPPNTK PSSNCRREKE EEEIDLGFWK PALDSKNSLS SMPKSDASFE  60
LSLRIPAPSA PSSGHSLSPI QQQQYGLAQG LRFLRPIRGI PVYQNYPPPS FPFSQDHNPS  120
YSTTRTNTPS GLVQTQGVIR SRFLSRFPAK RSMRAPRMRW TTTLHARFVH AVELLGGQER  180
ATPKSVLELM DVKDLTLAHV KSHLQMYRTV KTTDRAPTSP GQSELYETGS SGVTSEDMMF  240
DVENPRKSEV SVQQGRPNLN QDNDNYHGLW SNSSSDRIRY PLRKSVREKK KRKREKKEKS  300
GKERQGRKQQ KLKGGKKHVL S*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1288296KKKRKREKK
2289296KKRKREKK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00174DAPTransfer from AT1G32240Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010663129.11e-120PREDICTED: probable transcription factor KAN2 isoform X1
SwissprotQ9C6165e-58KAN2_ARATH; Probable transcription factor KAN2
TrEMBLF6HT561e-119F6HT56_VITVI; Putative uncharacterized protein
STRINGVIT_02s0012g01940.t011e-119(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27382255
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.18e-59G2-like family protein